PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039213
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 296aa    MW: 33289.7 Da    PI: 6.9001
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039213genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.2e-141663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l  ++ + G g+W+t++   g+ R +k+c++rw +yl
      Lus10039213 16 KGLWSPEEDHRLRSYIVKNGHGCWTTVPINAGLQRNGKSCRLRWINYL 63
                     678*******************************************97 PP

2Myb_DNA-binding51.13.1e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++ E++ +v ++++lG++ W+ I+++++ gRt++++k++w++yl
      Lus10039213  69 RGLFSAHEEDTIVTLHRLLGNK-WSQISQHLP-GRTDNEIKNHWHSYL 114
                      7889******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-19865IPR009057Homeodomain-like
PROSITE profilePS5129417.3261163IPR017930Myb domain
SuperFamilySSF466892.79E-2713110IPR009057Homeodomain-like
SMARTSM007173.0E-81565IPR001005SANT/Myb domain
PfamPF002492.0E-121663IPR001005SANT/Myb domain
CDDcd001672.38E-71963No hitNo description
PROSITE profilePS5129425.27764118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2466118IPR009057Homeodomain-like
SMARTSM007172.6E-1468116IPR001005SANT/Myb domain
PfamPF002494.1E-1469114IPR001005SANT/Myb domain
CDDcd001671.33E-1072114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MEECKDQKPT KPKHRKGLWS PEEDHRLRSY IVKNGHGCWT TVPINAGLQR NGKSCRLRWI  60
NYLRPGLRRG LFSAHEEDTI VTLHRLLGNK WSQISQHLPG RTDNEIKNHW HSYLKKKLTK  120
SQGIASNDNN NNKIQQFPSS SNSDNNPSTN HNLSQDHRDE PALSSTTTSA TDKYSVPLLP  180
PKLIFAEWLS MDSFPTNPAA EPLFCDRDFA SGSSEYGLDI PNSGFFSDHL FQGGYQLCGE  240
RGGYRNSMAT TVSDGSASDV FSSQFNFEDQ SSDNSSQFVE FCSDFQINSD SVLYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-21161187108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744470.0JX174447.1 Linum usitatissimum clone LuBAC375N24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321912.25e-87hypothetical protein POPTR_0015s13190g
SwissprotQ9M0K43e-61LAF1_ARATH; Transcription factor LAF1
TrEMBLB9ID765e-87B9ID76_POPTR; Uncharacterized protein
STRINGPOPTR_0015s13190.12e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.13e-60myb domain protein 18